PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000274301
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 361aa    MW: 40554.6 Da    PI: 9.8266
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000274301genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding569e-1865112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT+eEd++l+ +++++G g+W++ + + g+ R++k+c++rw +yl
    MDP0000274301  65 KGPWTPEEDQKLLAYIEEHGHGSWRALPTKAGLQRCGKSCRLRWTNYL 112
                      79********************************************97 PP

2Myb_DNA-binding537.8e-17118163148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++ +E++ +++++++lG++ W++Ia +++ +Rt++++k++w+++l
    MDP0000274301 118 RGKFSLQEEQTIIQLHALLGNR-WSAIATHLP-KRTDNEIKNYWNTHL 163
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.8E-2656115IPR009057Homeodomain-like
PROSITE profilePS5129418.01560112IPR017930Myb domain
SuperFamilySSF466891.47E-3062159IPR009057Homeodomain-like
SMARTSM007174.0E-1464114IPR001005SANT/Myb domain
PfamPF002491.6E-1665112IPR001005SANT/Myb domain
CDDcd001674.58E-1167112No hitNo description
PROSITE profilePS5129425.891113167IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.6E-26116167IPR009057Homeodomain-like
SMARTSM007171.2E-16117165IPR001005SANT/Myb domain
PfamPF002494.2E-16118163IPR001005SANT/Myb domain
CDDcd001673.17E-11120163No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MALDLQTLTE CLKYLRGCRY FHRSIRKSRI DMERGRGGEI KTSSYVDENI PMGRSPCCDK  60
VGLKKGPWTP EEDQKLLAYI EEHGHGSWRA LPTKAGLQRC GKSCRLRWTN YLRPDIKRGK  120
FSLQEEQTII QLHALLGNRW SAIATHLPKR TDNEIKNYWN THLKKRLAKM GIDPVTHKPK  180
KDNLLSSVDG QSKNASNLSH MAQWESARLE AEARLVRESR LRSQSSSLLH QLTTTNPNTY  240
VPVNSSSSGS TSAQLQLKWP SSKHSHNSVD LESPTSTLTY NSDQINVNHA SSSAMGAAIM  300
QPAMIEFVGS SGSSETKEEG GDNEQDWKSH LSFTPLGFSN HGVMSIEPQR KEKEGREGRA  360
N
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-26631675108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.119390.0bud| fruit
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008366447.10.0PREDICTED: myb-related protein 315-like
TrEMBLM5WYQ51e-160M5WYQ5_PRUPE; Uncharacterized protein
STRINGPOPTR_0017s12230.11e-129(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF83534127
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.11e-105myb domain protein 16